SCOPe 2.06: Domain d3bbra_: 3bbr A:

Lineage for d3bbra_ (3bbr A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)

8. Domain d3bbra_: 3bbr A: [155091]
   Other proteins in same PDB: d3bbrb3
   automated match to d1lbcb_
   protein/RNA complex; complexed with bhy, cl, glu, gol, so4

Details for d3bbra_

PDB Entry: 3bbr, 2.25 Å

PDB Description: crystal structure of the iglur2 ligand binding core (s1s2j-n775s) in complex with a dimeric positive modulator as well as glutamate at 2.25 a resolution

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d3bbra_:

Sequence, based on SEQRES records:

>d3bbra_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgec

Sequence, based on observed residues (ATOM records):

>d3bbra_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwyec

Timeline for d3bbra_:

• d3bbra_ first appeared in SCOP 1.75, called d3bbra1
  
• d3bbra_ appears in SCOPe 2.05
  
• d3bbra_ appears in SCOPe 2.07
  
• d3bbra_ appears in the current release, SCOPe 2.08