| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries) |
| Domain d3bbox1: 3bbo X:76-135 [155090] |
PDB Entry: 3bbo (more details), 9.4 Å
SCOPe Domain Sequences for d3bbox1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbox1 i.1.1.1 (X:76-135) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
qrlgvkiygdqvakpgaiivrqrgtkfhagknvgigkdhtifslidglvkfekfgpdrkk
Timeline for d3bbox1: