Lineage for d3bbox1 (3bbo X:76-135)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3043318Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species)
  7. 3043319Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries)
  8. 3043337Domain d3bbox1: 3bbo X:76-135 [155090]

Details for d3bbox1

PDB Entry: 3bbo (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome
PDB Compounds: (X:) ribosomal protein L27

SCOPe Domain Sequences for d3bbox1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbox1 i.1.1.1 (X:76-135) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
qrlgvkiygdqvakpgaiivrqrgtkfhagknvgigkdhtifslidglvkfekfgpdrkk

SCOPe Domain Coordinates for d3bbox1:

Click to download the PDB-style file with coordinates for d3bbox1.
(The format of our PDB-style files is described here.)

Timeline for d3bbox1: