Lineage for d3bbov1 (3bbo V:112-188)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070155Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries)
  8. 1070165Domain d3bbov1: 3bbo V:112-188 [155089]
    Other proteins in same PDB: d3bboh1, d3bboo1, d3bbop1
    automatically matched to d1s1it_

Details for d3bbov1

PDB Entry: 3bbo (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome
PDB Compounds: (V:) ribosomal protein l23

SCOPe Domain Sequences for d3bbov1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbov1 i.1.1.1 (V:112-188) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
yqilqspiiteaaikniadensllftvdvradkkmireaisnffgvkvrkvntlirpdgt
kkayimlnkeynasela

SCOPe Domain Coordinates for d3bbov1:

Click to download the PDB-style file with coordinates for d3bbov1.
(The format of our PDB-style files is described here.)

Timeline for d3bbov1: