Lineage for d3bboo1 (3bbo O:7-130)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1711204Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1711205Protein 50S subunit [58125] (6 species)
  7. 1711639Species Spinach (Spinacia oleracea) [TaxId:3562] [161281] (1 PDB entry)
  8. 1711641Domain d3bboo1: 3bbo O:7-130 [155086]
    Other proteins in same PDB: d3bbo61, d3bboj1, d3bbok1, d3bbol1, d3bbou1, d3bbov1, d3bbox1
    automatically matched to d1njmk_

Details for d3bboo1

PDB Entry: 3bbo (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome
PDB Compounds: (O:) ribosomal protein L16

SCOPe Domain Sequences for d3bboo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bboo1 i.1.1.2 (O:7-130) 50S subunit {Spinach (Spinacia oleracea) [TaxId: 3562]}
trfrkqhrgrmkgisyrgnricfgryalqalepawitsrqieagrramtrnarrggkiwv
rifpdkpvtvrpaetrmgsgkgspeywvavvkpgrilyeisgvaeniarravaiaaskmp
irtq

SCOPe Domain Coordinates for d3bboo1:

Click to download the PDB-style file with coordinates for d3bboo1.
(The format of our PDB-style files is described here.)

Timeline for d3bboo1: