Lineage for d3bbol1 (3bbo L:112-236)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1971461Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species)
  7. 1971462Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries)
  8. 1971475Domain d3bbol1: 3bbo L:112-236 [155085]

Details for d3bbol1

PDB Entry: 3bbo (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome
PDB Compounds: (L:) ribosomal protein l13

SCOPe Domain Sequences for d3bbol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbol1 i.1.1.1 (L:112-236) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
kkwyvvdatdlilgrmastiaihirgknlasytpsvdmgafvivvnadkvavsgkkrtqk
lyrrhsgrpgglkeetfdqlqkriperiiehavrgmlpkgrlgrylfnhlkvykgaehph
qaqqp

SCOPe Domain Coordinates for d3bbol1:

Click to download the PDB-style file with coordinates for d3bbol1.
(The format of our PDB-style files is described here.)

Timeline for d3bbol1: