![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species) |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries) |
![]() | Domain d3bbok1: 3bbo K:80-210 [155084] |
PDB Entry: 3bbo (more details), 9.4 Å
SCOPe Domain Sequences for d3bbok1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbok1 i.1.1.1 (K:80-210) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]} iklaleagkatpappvgpalgskgvnimafckdynartadkpgfvipveitvfddksftf ilktppasvlllkasgaekgskdpqmekvgkitidqlrgiateklpdlncttiesamrii agtaanmgidi
Timeline for d3bbok1: