SCOPe 2.03: Domain d3bboj1: 3bbo J:51-118

Lineage for d3bboj1 (3bbo J:51-118)

1. Root: SCOPe 2.03

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries)

8. Domain d3bboj1: 3bbo J:51-118 [155083]
   Other proteins in same PDB: d3bboh1, d3bboo1, d3bbop1
   automatically matched to d1p85f_

Details for d3bboj1

PDB Entry: 3bbo, 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 50S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome

PDB Compounds: (J:) ribosomal protein l9

SCOPe Domain Sequences for d3bboj1:

Sequence; same for both SEQRES and ATOM records:

>d3bboj1 i.1.1.1 (J:51-118) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kvilkedvtdlgkqgqlldvkagffrnfllptgkaqlmtplllkelkmederieaekqrv
keeaqqla

Timeline for d3bboj1:

• d3bboj1 first appeared in SCOP 1.75
  
• d3bboj1 appears in SCOPe 2.02
  
• d3bboj1 appears in SCOPe 2.04
  
• d3bboj1 appears in the current release, SCOPe 2.08