Lineage for d3bbnr1 (3bbn R:26-77)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2269078Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species)
  7. 2269079Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries)
  8. 2269086Domain d3bbnr1: 3bbn R:26-77 [155079]

Details for d3bbnr1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (R:) ribosomal protein s18

SCOPe Domain Sequences for d3bbnr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbnr1 i.1.1.1 (R:26-77) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
dridyrnmslisrfiseqgkilsrrvnrltlkqqrlitsaikqarilsllpf

SCOPe Domain Coordinates for d3bbnr1:

Click to download the PDB-style file with coordinates for d3bbnr1.
(The format of our PDB-style files is described here.)

Timeline for d3bbnr1: