Lineage for d3bbnr1 (3bbn R:26-77)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710986Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [161278] (2 PDB entries)
  8. 1710989Domain d3bbnr1: 3bbn R:26-77 [155079]
    automatically matched to d1gixu_

Details for d3bbnr1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (R:) ribosomal protein s18

SCOPe Domain Sequences for d3bbnr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbnr1 i.1.1.1 (R:26-77) 70S ribosome functional complex {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dridyrnmslisrfiseqgkilsrrvnrltlkqqrlitsaikqarilsllpf

SCOPe Domain Coordinates for d3bbnr1:

Click to download the PDB-style file with coordinates for d3bbnr1.
(The format of our PDB-style files is described here.)

Timeline for d3bbnr1: