Lineage for d3bbnk1 (3bbn K:23-122)

  1. Root: SCOPe 2.01
  2. 1069520Class i: Low resolution protein structures [58117] (25 folds)
  3. 1069521Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1069522Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1069523Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1069524Protein 70S ribosome functional complex [58121] (9 species)
  7. 1070149Species Mesembryanthemum crystallinum [TaxId:3544] [161277] (1 PDB entry)
  8. 1070151Domain d3bbnk1: 3bbn K:23-122 [155076]
    automatically matched to d1p6gk_

Details for d3bbnk1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (K:) ribosomal protein s11

SCOPe Domain Sequences for d3bbnk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbnk1 i.1.1.1 (K:23-122) 70S ribosome functional complex {Mesembryanthemum crystallinum [TaxId: 3544]}
rkipkgvihvqasfnntivtvtdvrgrvvswasagtcgfrgtkrgtpfaaqtaagnairt
vveqgmqraevmikgpglgrdaalrairrsgillsfvrdv

SCOPe Domain Coordinates for d3bbnk1:

Click to download the PDB-style file with coordinates for d3bbnk1.
(The format of our PDB-style files is described here.)

Timeline for d3bbnk1: