Lineage for d3bbnj1 (3bbn J:100-195)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3043318Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species)
  7. 3043319Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries)
  8. 3043322Domain d3bbnj1: 3bbn J:100-195 [155075]

Details for d3bbnj1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (J:) ribosomal protein s10

SCOPe Domain Sequences for d3bbnj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbnj1 i.1.1.1 (J:100-195) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
kiriklrsywvpliedsckqimdaarttnaktmgpvplptkkrifcvlksphvhkdarfh
feirthqrlidilyptaqtidslmqldlpagvdvev

SCOPe Domain Coordinates for d3bbnj1:

Click to download the PDB-style file with coordinates for d3bbnj1.
(The format of our PDB-style files is described here.)

Timeline for d3bbnj1: