Lineage for d3bbng1 (3bbn G:2-155)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647896Protein Eukaryotic, chloroplast (70S ribosome functional complex) [267637] (1 species)
  7. 2647897Species Spinach (Spinacia oleracea) [TaxId:3562] [267691] (2 PDB entries)
  8. 2647899Domain d3bbng1: 3bbn G:2-155 [155074]

Details for d3bbng1

PDB Entry: 3bbn (more details), 9.4 Å

PDB Description: Homology model for the Spinach chloroplast 30S subunit fitted to 9.4A cryo-EM map of the 70S chlororibosome.
PDB Compounds: (G:) ribosomal protein s7

SCOPe Domain Sequences for d3bbng1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbng1 i.1.1.1 (G:2-155) Eukaryotic, chloroplast (70S ribosome functional complex) {Spinach (Spinacia oleracea) [TaxId: 3562]}
srrgtveektaksdpiyrnrlvnmlvnrilkhgkkslayqilyravkkiqqktetnplsv
lrqairgvtpdiavkarrvggsthqvpieigstqgkalairwllgaarkrpgrnmafkls
selvdaakgsgdavrkkeethrmaeanrafahfr

SCOPe Domain Coordinates for d3bbng1:

Click to download the PDB-style file with coordinates for d3bbng1.
(The format of our PDB-style files is described here.)

Timeline for d3bbng1: