Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.6: EMG1/NEP1-like [159513] (3 proteins) Pfam PF03587; structurally most similar to the AF1056-like family, but more decorated |
Protein Ribosome biogenesis protein NEP1 [159514] (1 species) |
Species Methanococcus jannaschii [TaxId:2190] [159515] (3 PDB entries) Uniprot Q57977 2-205 |
Domain d3bbhb_: 3bbh B: [155072] automated match to d3bbda1 protein/RNA complex; complexed with gol, sfg |
PDB Entry: 3bbh (more details), 2.25 Å
SCOPe Domain Sequences for d3bbhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbhb_ c.116.1.6 (B:) Ribosome biogenesis protein NEP1 {Methanococcus jannaschii [TaxId: 2190]} tyniilaksalelipeeiknkirksrvykydildsnyhykameklkdkemrgrpdiihis llnildspinhekklniyihtyddkvlkinpetrlprnyfrflgvmekvlkgernhlikm eektledllneinakkiaimtktgklthpkllkeydtfiiggfpygklkinkekvfgdik eisiynkglmawtvcgiicyslsf
Timeline for d3bbhb_: