Lineage for d1a0ud_ (1a0u D:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44242Protein Hemoglobin, beta-chain [46500] (16 species)
  7. 44286Species Human (Homo sapiens) [TaxId:9606] [46501] (71 PDB entries)
  8. 44379Domain d1a0ud_: 1a0u D: [15507]
    Other proteins in same PDB: d1a0ua_, d1a0uc_

Details for d1a0ud_

PDB Entry: 1a0u (more details), 2.14 Å

PDB Description: hemoglobin (val beta1 met) mutant

SCOP Domain Sequences for d1a0ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0ud_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1a0ud_:

Click to download the PDB-style file with coordinates for d1a0ud_.
(The format of our PDB-style files is described here.)

Timeline for d1a0ud_: