SCOPe 2.07: Domain d3bbfe_: 3bbf E:

Lineage for d3bbfe_ (3bbf E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)

8. Domain d3bbfe_: 3bbf E: [155069]
   automated match to d1nuea_
   protein/DNA complex; complexed with dtt, gdp, mg

Details for d3bbfe_

PDB Entry: 3bbf, 1.7 Å

PDB Description: Crystal structure of the NM23-H2 transcription factor complex with GDP

PDB Compounds: (E:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d3bbfe_:

Sequence; same for both SEQRES and ATOM records:

>d3bbfe_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

Timeline for d3bbfe_:

• d3bbfe_ first appeared in SCOP 1.75, called d3bbfe1
  
• d3bbfe_ appears in SCOPe 2.06
  
• d3bbfe_ appears in the current release, SCOPe 2.08