![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
![]() | Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54922] (4 PDB entries) |
![]() | Domain d3bbfb1: 3bbf B:2-151 [155066] automatically matched to d1nskl_ complexed with dtt, gdp, mg |
PDB Entry: 3bbf (more details), 1.7 Å
SCOP Domain Sequences for d3bbfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbfb1 d.58.6.1 (B:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd svksaekeislwfkpeelvdykscahdwvy
Timeline for d3bbfb1: