Lineage for d3bbfa1 (3bbf A:2-151)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861820Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 861821Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 861822Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 861928Species Human (Homo sapiens) [TaxId:9606] [54922] (4 PDB entries)
  8. 861935Domain d3bbfa1: 3bbf A:2-151 [155065]
    automatically matched to d1nskl_
    complexed with dtt, gdp, mg

Details for d3bbfa1

PDB Entry: 3bbf (more details), 1.7 Å

PDB Description: Crystal structure of the NM23-H2 transcription factor complex with GDP
PDB Compounds: (A:) Nucleoside diphosphate kinase B

SCOP Domain Sequences for d3bbfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbfa1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvy

SCOP Domain Coordinates for d3bbfa1:

Click to download the PDB-style file with coordinates for d3bbfa1.
(The format of our PDB-style files is described here.)

Timeline for d3bbfa1: