Lineage for d3bbfa_ (3bbf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951072Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2951127Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)
  8. 2951140Domain d3bbfa_: 3bbf A: [155065]
    automated match to d1nuea_
    protein/DNA complex; complexed with dtt, gdp, mg

Details for d3bbfa_

PDB Entry: 3bbf (more details), 1.7 Å

PDB Description: Crystal structure of the NM23-H2 transcription factor complex with GDP
PDB Compounds: (A:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d3bbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbfa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

SCOPe Domain Coordinates for d3bbfa_:

Click to download the PDB-style file with coordinates for d3bbfa_.
(The format of our PDB-style files is described here.)

Timeline for d3bbfa_: