SCOP 1.75: Domain d3bbda1: 3bbd A:2-205

Lineage for d3bbda1 (3bbd A:2-205)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (8 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.6: EMG1/NEP1-like [159513] (2 proteins)
   Pfam PF03587; structurally most similar to the AF1056-like family, but more decorated

6. Protein Ribosome biogenesis protein NEP1 [159514] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [159515] (3 PDB entries)
   Uniprot Q57977 2-205

8. Domain d3bbda1: 3bbd A:2-205 [155061]
   complexed with gol, sah

Details for d3bbda1

PDB Entry: 3bbd, 2.15 Å

PDB Description: M. jannaschii Nep1 complexed with S-adenosyl-homocysteine

PDB Compounds: (A:) Ribosome biogenesis protein NEP1-like

SCOP Domain Sequences for d3bbda1:

Sequence; same for both SEQRES and ATOM records:

>d3bbda1 c.116.1.6 (A:2-205) Ribosome biogenesis protein NEP1 {Methanococcus jannaschii [TaxId: 2190]}
tyniilaksalelipeeiknkirksrvykydildsnyhykameklkdkemrgrpdiihis
llnildspinhekklniyihtyddkvlkinpetrlprnyfrflgvmekvlkgernhlikm
eektledllneinakkiaimtktgklthpkllkeydtfiiggfpygklkinkekvfgdik
eisiynkglmawtvcgiicyslsf

Timeline for d3bbda1:

• d3bbda1 is new in SCOP 1.75
  
• d3bbda1 appears in SCOPe 2.01
  
• d3bbda1 appears in the current release, SCOPe 2.08