Lineage for d3bbbe_ (3bbb E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2557936Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2557937Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2557992Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)
  8. 2557997Domain d3bbbe_: 3bbb E: [155059]
    automated match to d1nuea_
    protein/DNA complex; complexed with da, dg

Details for d3bbbe_

PDB Entry: 3bbb (more details), 1.3 Å

PDB Description: Crystal structure of the NM23-H2 transcription factor complex with dinucleotide d(AG)
PDB Compounds: (E:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d3bbbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbbe_ d.58.6.1 (E:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
ertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpffpgl
vkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsdsvk
saekeislwfkpeelvdykscahdwvye

SCOPe Domain Coordinates for d3bbbe_:

Click to download the PDB-style file with coordinates for d3bbbe_.
(The format of our PDB-style files is described here.)

Timeline for d3bbbe_: