Lineage for d3bbba_ (3bbb A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415051Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1415052Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 1415107Species Human (Homo sapiens) [TaxId:9606] [54922] (5 PDB entries)
  8. 1415108Domain d3bbba_: 3bbb A: [155055]
    automated match to d1nuea_
    protein/DNA complex; complexed with da, dg

Details for d3bbba_

PDB Entry: 3bbb (more details), 1.3 Å

PDB Description: Crystal structure of the NM23-H2 transcription factor complex with dinucleotide d(AG)
PDB Compounds: (A:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d3bbba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbba_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]}
anlertfiaikpdgvqrglvgeiikrfeqkgfrlvamkflraseehlkqhyidlkdrpff
pglvkymnsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgsd
svksaekeislwfkpeelvdykscahdwvye

SCOPe Domain Coordinates for d3bbba_:

Click to download the PDB-style file with coordinates for d3bbba_.
(The format of our PDB-style files is described here.)

Timeline for d3bbba_: