SCOPe 2.07: Domain d3bb9f_: 3bb9 F:

Lineage for d3bb9f_ (3bb9 F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.16: SO0125-like [159991] (2 proteins)
   PfamB PB003666
   automatically mapped to Pfam PF13474

6. Protein Uncharacterized protein Sfri1973 [159992] (1 species)

7. Species Shewanella frigidimarina [TaxId:56812] [159993] (1 PDB entry)
   Uniprot Q082J6 23-147

8. Domain d3bb9f_: 3bb9 F: [155054]
   automated match to d3bb9a1
   complexed with edo

Details for d3bb9f_

PDB Entry: 3bb9, 1.8 Å

PDB Description: crystal structure of a putative ketosteroid isomerase (sfri_1973) from shewanella frigidimarina ncimb 400 at 1.80 a resolution

PDB Compounds: (F:) Putative orphan protein

SCOPe Domain Sequences for d3bb9f_:

Sequence; same for both SEQRES and ATOM records:

>d3bb9f_ d.17.4.16 (F:) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}
dsaagnvvkqfhaalqmgneaivrqslaanvqiyeggkverslteyanhhmladmaylkg
ltitpkehqititgdiaistsishaqgeykgksidsmtmetlvlikqadgrwkithvhws

Timeline for d3bb9f_:

• d3bb9f_ first appeared in SCOP 1.75, called d3bb9f1
  
• d3bb9f_ appears in SCOPe 2.06
  
• d3bb9f_ appears in the current release, SCOPe 2.08