| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.16: SO0125-like [159991] (2 proteins) PfamB PB003666 automatically mapped to Pfam PF13474 |
| Protein Uncharacterized protein Sfri1973 [159992] (1 species) |
| Species Shewanella frigidimarina [TaxId:56812] [159993] (1 PDB entry) Uniprot Q082J6 23-147 |
| Domain d3bb9f_: 3bb9 F: [155054] automated match to d3bb9a1 complexed with edo |
PDB Entry: 3bb9 (more details), 1.8 Å
SCOPe Domain Sequences for d3bb9f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bb9f_ d.17.4.16 (F:) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}
dsaagnvvkqfhaalqmgneaivrqslaanvqiyeggkverslteyanhhmladmaylkg
ltitpkehqititgdiaistsishaqgeykgksidsmtmetlvlikqadgrwkithvhws
Timeline for d3bb9f_: