Lineage for d3bb9f1 (3bb9 F:28-147)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 856030Family d.17.4.16: SO0125-like [159991] (2 proteins)
    PfamB PB003666
  6. 856031Protein Uncharacterized protein Sfri1973 [159992] (1 species)
  7. 856032Species Shewanella frigidimarina [TaxId:56812] [159993] (1 PDB entry)
    Uniprot Q082J6 23-147
  8. 856038Domain d3bb9f1: 3bb9 F:28-147 [155054]
    automatically matched to 3BB9 A:27-147
    complexed with edo

Details for d3bb9f1

PDB Entry: 3bb9 (more details), 1.8 Å

PDB Description: crystal structure of a putative ketosteroid isomerase (sfri_1973) from shewanella frigidimarina ncimb 400 at 1.80 a resolution
PDB Compounds: (F:) Putative orphan protein

SCOP Domain Sequences for d3bb9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bb9f1 d.17.4.16 (F:28-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}
dsaagnvvkqfhaalqmgneaivrqslaanvqiyeggkverslteyanhhmladmaylkg
ltitpkehqititgdiaistsishaqgeykgksidsmtmetlvlikqadgrwkithvhws

SCOP Domain Coordinates for d3bb9f1:

Click to download the PDB-style file with coordinates for d3bb9f1.
(The format of our PDB-style files is described here.)

Timeline for d3bb9f1: