SCOP 1.75: Domain d3bb9e1: 3bb9 E:27-147

Lineage for d3bb9e1 (3bb9 E:27-147)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (30 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.16: SO0125-like [159991] (2 proteins)
   PfamB PB003666

6. Protein Uncharacterized protein Sfri1973 [159992] (1 species)

7. Species Shewanella frigidimarina [TaxId:56812] [159993] (1 PDB entry)
   Uniprot Q082J6 23-147

8. Domain d3bb9e1: 3bb9 E:27-147 [155053]
   automatically matched to 3BB9 A:27-147
   complexed with edo

Details for d3bb9e1

PDB Entry: 3bb9, 1.8 Å

PDB Description: crystal structure of a putative ketosteroid isomerase (sfri_1973) from shewanella frigidimarina ncimb 400 at 1.80 a resolution

PDB Compounds: (E:) Putative orphan protein

SCOP Domain Sequences for d3bb9e1:

Sequence; same for both SEQRES and ATOM records:

>d3bb9e1 d.17.4.16 (E:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]}
vdsaagnvvkqfhaalqmgneaivrqslaanvqiyeggkverslteyanhhmladmaylk
gltitpkehqititgdiaistsishaqgeykgksidsmtmetlvlikqadgrwkithvhw
s

Timeline for d3bb9e1:

• d3bb9e1 is new in SCOP 1.75
  
• d3bb9e1 appears in SCOPe 2.01
  
• d3bb9e1 appears in the current release, SCOPe 2.08, called d3bb9e_