![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (20 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (19 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (114 PDB entries) |
![]() | Domain d1a0xd_: 1a0x D: [15505] Other proteins in same PDB: d1a0xa_, d1a0xc_ complexed with hem; mutant |
PDB Entry: 1a0x (more details), 2 Å
SCOP Domain Sequences for d1a0xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0xd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)} mhltpeeksavtalwgkvnvdevggealgrllvvypgtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1a0xd_: