Lineage for d3bb6d_ (3bb6 D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963404Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 963667Family b.82.2.13: TehB-like [159307] (2 proteins)
    Pfam PF09313; DUF1971
  6. 963678Protein Uncharacterized protein YeaR [159308] (1 species)
  7. 963679Species Escherichia coli [TaxId:562] [159309] (1 PDB entry)
    Uniprot P64488 1-109
  8. 963683Domain d3bb6d_: 3bb6 D: [155048]
    automated match to d3bb6a1
    complexed with zn

Details for d3bb6d_

PDB Entry: 3bb6 (more details), 2.3 Å

PDB Description: crystal structure of the p64488 protein from e.coli (strain k12). northeast structural genomics consortium target er596
PDB Compounds: (D:) Uncharacterized protein yeaR

SCOPe Domain Sequences for d3bb6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bb6d_ b.82.2.13 (D:) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]}
mlqipqnyihtrstpfwnkqtapagiferhldkgtrpgvyprlsvmhgavkylgyadehs
aepdqvilieagqfavfppekwhnieamtddtyfnidffvape

SCOPe Domain Coordinates for d3bb6d_:

Click to download the PDB-style file with coordinates for d3bb6d_.
(The format of our PDB-style files is described here.)

Timeline for d3bb6d_: