![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.13: TehB-like [159307] (2 proteins) Pfam PF09313; DUF1971 |
![]() | Protein Uncharacterized protein YeaR [159308] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [159309] (1 PDB entry) Uniprot P64488 1-109 |
![]() | Domain d3bb6c1: 3bb6 C:1-109 [155047] automatically matched to 3BB6 A:1-109 complexed with zn |
PDB Entry: 3bb6 (more details), 2.3 Å
SCOP Domain Sequences for d3bb6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bb6c1 b.82.2.13 (C:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} mlqipqnyihtrstpfwnkqtapagiferhldkgtrpgvyprlsvmhgavkylgyadehs aepdqvilieagqfavfppekwhnieamtddtyfnidffvapevlmega
Timeline for d3bb6c1: