SCOPe 2.01: Domain d3bb6b_: 3bb6 B:

Lineage for d3bb6b_ (3bb6 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.13: TehB-like [159307] (2 proteins)
   Pfam PF09313; DUF1971

6. Protein Uncharacterized protein YeaR [159308] (1 species)

7. Species Escherichia coli [TaxId:562] [159309] (1 PDB entry)
   Uniprot P64488 1-109

8. Domain d3bb6b_: 3bb6 B: [155046]
   automated match to d3bb6a1
   complexed with zn

Details for d3bb6b_

PDB Entry: 3bb6, 2.3 Å

PDB Description: crystal structure of the p64488 protein from e.coli (strain k12). northeast structural genomics consortium target er596

PDB Compounds: (B:) Uncharacterized protein yeaR

SCOPe Domain Sequences for d3bb6b_:

Sequence; same for both SEQRES and ATOM records:

>d3bb6b_ b.82.2.13 (B:) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]}
mlqipqnyihtrstpfwnkqtapagiferhldkgtrpgvyprlsvmhgavkylgyadehs
aepdqvilieagqfavfppekwhnieamtddtyfnidffvapevlmegaqq

Timeline for d3bb6b_:

• d3bb6b_ first appeared in SCOP 1.75, called d3bb6b1
  
• d3bb6b_ appears in SCOPe 2.02
  
• d3bb6b_ appears in the current release, SCOPe 2.08