SCOP 1.75: Domain d3bb6b1: 3bb6 B:1-109

Lineage for d3bb6b1 (3bb6 B:1-109)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.13: TehB-like [159307] (2 proteins)
   Pfam PF09313; DUF1971

6. Protein Uncharacterized protein YeaR [159308] (1 species)

7. Species Escherichia coli [TaxId:562] [159309] (1 PDB entry)
   Uniprot P64488 1-109

8. Domain d3bb6b1: 3bb6 B:1-109 [155046]
   automatically matched to 3BB6 A:1-109
   complexed with zn

Details for d3bb6b1

PDB Entry: 3bb6, 2.3 Å

PDB Description: crystal structure of the p64488 protein from e.coli (strain k12). northeast structural genomics consortium target er596

PDB Compounds: (B:) Uncharacterized protein yeaR

SCOP Domain Sequences for d3bb6b1:

Sequence; same for both SEQRES and ATOM records:

>d3bb6b1 b.82.2.13 (B:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]}
mlqipqnyihtrstpfwnkqtapagiferhldkgtrpgvyprlsvmhgavkylgyadehs
aepdqvilieagqfavfppekwhnieamtddtyfnidffvapevlmega

Timeline for d3bb6b1:

• d3bb6b1 is new in SCOP 1.75
  
• d3bb6b1 is called d3bb6b_ in SCOPe 2.01
  
• d3bb6b1 appears in the current release, SCOPe 2.08, called d3bb6b_