Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.13: TehB-like [159307] (2 proteins) Pfam PF09313; DUF1971 |
Protein Uncharacterized protein YeaR [159308] (1 species) |
Species Escherichia coli [TaxId:562] [159309] (1 PDB entry) Uniprot P64488 1-109 |
Domain d3bb6a1: 3bb6 A:1-109 [155045] complexed with zn |
PDB Entry: 3bb6 (more details), 2.3 Å
SCOPe Domain Sequences for d3bb6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} mlqipqnyihtrstpfwnkqtapagiferhldkgtrpgvyprlsvmhgavkylgyadehs aepdqvilieagqfavfppekwhnieamtddtyfnidffvapevlmega
Timeline for d3bb6a1: