Lineage for d3bb6a1 (3bb6 A:1-109)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807787Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1808075Family b.82.2.13: TehB-like [159307] (2 proteins)
    Pfam PF09313; DUF1971
  6. 1808086Protein Uncharacterized protein YeaR [159308] (1 species)
  7. 1808087Species Escherichia coli [TaxId:562] [159309] (1 PDB entry)
    Uniprot P64488 1-109
  8. 1808088Domain d3bb6a1: 3bb6 A:1-109 [155045]
    complexed with zn

Details for d3bb6a1

PDB Entry: 3bb6 (more details), 2.3 Å

PDB Description: crystal structure of the p64488 protein from e.coli (strain k12). northeast structural genomics consortium target er596
PDB Compounds: (A:) Uncharacterized protein yeaR

SCOPe Domain Sequences for d3bb6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]}
mlqipqnyihtrstpfwnkqtapagiferhldkgtrpgvyprlsvmhgavkylgyadehs
aepdqvilieagqfavfppekwhnieamtddtyfnidffvapevlmega

SCOPe Domain Coordinates for d3bb6a1:

Click to download the PDB-style file with coordinates for d3bb6a1.
(The format of our PDB-style files is described here.)

Timeline for d3bb6a1: