SCOPe 2.01: Domain d3barb_: 3bar B:

Lineage for d3barb_ (3bar B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)

7. Species Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId:36329] [159376] (5 PDB entries)

8. Domain d3barb_: 3bar B: [155037]
   automated match to d2f84a1
   complexed with u5p

Details for d3barb_

PDB Entry: 3bar, 1.9 Å

PDB Description: Crystal structure of Plasmodium falciparum orotidine 5'-phosphate decarboxylase covalently modified by 6-azido-UMP

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3barb_:

Sequence; same for both SEQRES and ATOM records:

>d3barb_ c.1.2.3 (B:) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]}
smgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsik
kdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvl
knvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyd
eeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigf
vvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitkn
pypqkaaqmyydqinailkqnm

Timeline for d3barb_:

• d3barb_ first appeared in SCOP 1.75, called d3barb1
  
• d3barb_ appears in SCOPe 2.02
  
• d3barb_ appears in the current release, SCOPe 2.08, called d3barb2