Lineage for d3b9xa1 (3b9x A:3-310)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1180695Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 1180696Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 1180697Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins)
  6. 1180724Protein Pyrimidine nucleoside hydrolase YeiK [102633] (1 species)
  7. 1180725Species Escherichia coli [TaxId:562] [102634] (4 PDB entries)
  8. 1180738Domain d3b9xa1: 3b9x A:3-310 [155025]
    automatically matched to d1q8fa_
    complexed with ca, nos, tam

Details for d3b9xa1

PDB Entry: 3b9x (more details), 2.3 Å

PDB Description: Crystal structure of the E. coli pyrimidine nucleoside hydrolase YeiK in complex with inosine
PDB Compounds: (A:) Pyrimidine-specific ribonucleoside hydrolase rihB

SCOPe Domain Sequences for d3b9xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9xa1 c.70.1.1 (A:3-310) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli [TaxId: 562]}
krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp
vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv
pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv
plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat
cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv
eecvrgyi

SCOPe Domain Coordinates for d3b9xa1:

Click to download the PDB-style file with coordinates for d3b9xa1.
(The format of our PDB-style files is described here.)

Timeline for d3b9xa1: