Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) |
Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins) |
Protein Pyrimidine nucleoside hydrolase YeiK [102633] (1 species) |
Species Escherichia coli [TaxId:562] [102634] (4 PDB entries) |
Domain d3b9xa1: 3b9x A:3-310 [155025] automatically matched to d1q8fa_ complexed with ca, nos, tam |
PDB Entry: 3b9x (more details), 2.3 Å
SCOPe Domain Sequences for d3b9xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9xa1 c.70.1.1 (A:3-310) Pyrimidine nucleoside hydrolase YeiK {Escherichia coli [TaxId: 562]} krkiildcdpghddaiaimmaakhpaidllgitivagnqtldktlinglnvcqkleinvp vyagmpqpimrqqivadnihgdtgldgpvfepltrqaesthavkyiidtlmasdgditlv pvgplsniavamrmqpailpkireivlmggaygtgnftpsaefnifadpeaarvvftsgv plvmmgldltnqtvctpdviarmeraggpagelfsdimnftlktqfenyglaggpvhdat cigylinpdgiktqemyvevdvnsgpcygrtvcdelgvlgkpantkvgitidtdwfwglv eecvrgyi
Timeline for d3b9xa1: