![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
![]() | Superfamily d.80.1: Tautomerase/MIF [55331] (6 families) ![]() |
![]() | Family d.80.1.3: MIF-related [55339] (2 proteins) |
![]() | Protein Microphage migration inhibition factor (MIF) [55340] (5 species) synonym: glycosylation-inhibiting factor (GIF) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55341] (12 PDB entries) |
![]() | Domain d3b9sc1: 3b9s C:1-114 [155024] automatically matched to d1gcza_ complexed with gol, rw1, so4 |
PDB Entry: 3b9s (more details), 1.8 Å
SCOP Domain Sequences for d3b9sc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9sc1 d.80.1.3 (C:1-114) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]} pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
Timeline for d3b9sc1: