Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) |
Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
Protein Calcium ATPase [81658] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries) Uniprot P04191 |
Domain d3b9rb3: 3b9r B:361-599 [155020] Other proteins in same PDB: d3b9ra1, d3b9ra2, d3b9ra4, d3b9rb1, d3b9rb2, d3b9rb4 automatically matched to d1iwoa3 complexed with acp, alf, k, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3b9r (more details), 3 Å
SCOPe Domain Sequences for d3b9rb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9rb3 d.220.1.1 (B:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
Timeline for d3b9rb3:
View in 3D Domains from other chains: (mouse over for more information) d3b9ra1, d3b9ra2, d3b9ra3, d3b9ra4 |