SCOP 1.75: Domain d3b9rb1: 3b9r B:125-239

Lineage for d3b9rb1 (3b9r B:125-239)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (15 PDB entries)
   Uniprot P04191

8. Domain d3b9rb1: 3b9r B:125-239 [155018]
   Other proteins in same PDB: d3b9ra2, d3b9ra3, d3b9ra4, d3b9rb2, d3b9rb3, d3b9rb4
   automatically matched to d1iwoa1
   complexed with acp, alf, k, mg

Details for d3b9rb1

PDB Entry: 3b9r, 3 Å

PDB Description: SERCA Ca2+-ATPase E2 aluminium fluoride complex without thapsigargin

PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOP Domain Sequences for d3b9rb1:

Sequence; same for both SEQRES and ATOM records:

>d3b9rb1 b.82.7.1 (B:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d3b9rb1:

• d3b9rb1 is new in SCOP 1.75
  
• d3b9rb1 appears in SCOPe 2.01
  
• d3b9rb1 appears in the current release, SCOPe 2.08