Lineage for d3b9jj2 (3b9j J:224-414)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2593699Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2593700Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2593796Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2593855Protein automated matches [232070] (2 species)
    not a true protein
  7. 2593856Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries)
  8. 2593872Domain d3b9jj2: 3b9j J:224-414 [155009]
    Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb1, d3b9jc1, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj1, d3b9jk1, d3b9jk2
    automated match to d3b9jj2
    complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jj2

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
PDB Compounds: (J:) xanthine oxidase

SCOPe Domain Sequences for d3b9jj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9jj2 d.145.1.3 (J:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3b9jj2:

Click to download the PDB-style file with coordinates for d3b9jj2.
(The format of our PDB-style files is described here.)

Timeline for d3b9jj2: