![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins) automatically mapped to Pfam PF00941 |
![]() | Protein automated matches [232070] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries) |
![]() | Domain d3b9jj2: 3b9j J:224-414 [155009] Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb1, d3b9jc1, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj1, d3b9jk1, d3b9jk2 automated match to d3b9jj2 complexed with 290, ca, fad, fes, mos, mte |
PDB Entry: 3b9j (more details), 2.3 Å
SCOPe Domain Sequences for d3b9jj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9jj2 d.145.1.3 (J:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]} pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei llsieipysre
Timeline for d3b9jj2: