Lineage for d3b9ji2 (3b9j I:3-92)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638761Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1638928Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1639062Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 1639063Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. 1639077Domain d3b9ji2: 3b9j I:3-92 [155007]
    Other proteins in same PDB: d3b9ja1, d3b9jb1, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji1, d3b9jj1, d3b9jj2, d3b9jk1, d3b9jk2
    automated match to d1fiqa2
    complexed with 290, ca, fad, fes, mos, mte

Details for d3b9ji2

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
PDB Compounds: (I:) xanthine oxidase

SCOPe Domain Sequences for d3b9ji2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9ji2 d.15.4.2 (I:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3b9ji2:

Click to download the PDB-style file with coordinates for d3b9ji2.
(The format of our PDB-style files is described here.)

Timeline for d3b9ji2: