SCOPe 2.08: Domain d3b9ji2: 3b9j I:3-92

Lineage for d3b9ji2 (3b9j I:3-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Xanthine oxidase, N-terminal domain [54318] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
   Uniprot P80457

8. Domain d3b9ji2: 3b9j I:3-92 [155007]
   Other proteins in same PDB: d3b9ja1, d3b9jb1, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji1, d3b9jj1, d3b9jj2, d3b9jk1, d3b9jk2
   automated match to d1fiqa2
   complexed with 290, ca, fad, fes, mos, mte

Details for d3b9ji2

PDB Entry: 3b9j, 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine

PDB Compounds: (I:) xanthine oxidase

SCOPe Domain Sequences for d3b9ji2:

Sequence; same for both SEQRES and ATOM records:

>d3b9ji2 d.15.4.2 (I:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

Timeline for d3b9ji2:

• d3b9ji2 first appeared in SCOP 1.75
  
• d3b9ji2 appears in SCOPe 2.07