SCOPe 2.07: Domain d3b9jc1: 3b9j C:571-694

Lineage for d3b9jc1 (3b9j C:571-694)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)

6. Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
   Uniprot P80457

8. Domain d3b9jc1: 3b9j C:571-694 [155004]
   Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb1, d3b9jb2, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj1, d3b9jj2, d3b9jk2
   automated match to d1fiqc1
   complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jc1

PDB Entry: 3b9j, 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine

PDB Compounds: (C:) xanthine oxidase

SCOPe Domain Sequences for d3b9jc1:

Sequence; same for both SEQRES and ATOM records:

>d3b9jc1 d.41.1.1 (C:571-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3b9jc1:

• d3b9jc1 first appeared in SCOP 1.75
  
• d3b9jc1 appears in SCOPe 2.06
  
• d3b9jc1 appears in the current release, SCOPe 2.08