| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
| Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
| Protein Xanthine oxidase, domain 5 (?) [54670] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries) Uniprot P80457 |
| Domain d3b9jc1: 3b9j C:571-694 [155004] Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb1, d3b9jb2, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj1, d3b9jj2, d3b9jk2 automated match to d1fiqc1 complexed with 290, ca, fad, fes, mos, mte |
PDB Entry: 3b9j (more details), 2.3 Å
SCOPe Domain Sequences for d3b9jc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9jc1 d.41.1.1 (C:571-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa
Timeline for d3b9jc1: