Lineage for d3b9jb1 (3b9j B:415-528)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569625Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2569685Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2569686Protein automated matches [232090] (5 species)
    not a true protein
  7. 2569687Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries)
  8. 2569702Domain d3b9jb1: 3b9j B:415-528 [155002]
    Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj2, d3b9jk1, d3b9jk2
    automated match to d1v97a4
    complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jb1

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
PDB Compounds: (B:) xanthine oxidase

SCOPe Domain Sequences for d3b9jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9jb1 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOPe Domain Coordinates for d3b9jb1:

Click to download the PDB-style file with coordinates for d3b9jb1.
(The format of our PDB-style files is described here.)

Timeline for d3b9jb1: