Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [55453] (11 PDB entries) Uniprot P80457 |
Domain d3b9jb1: 3b9j B:415-528 [155002] Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj2, d3b9jk1, d3b9jk2 automatically matched to d1fo4a4 complexed with 290, ca, fad, fes, mos, mte |
PDB Entry: 3b9j (more details), 2.3 Å
SCOPe Domain Sequences for d3b9jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9jb1 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3b9jb1: