Lineage for d3b9jb1 (3b9j B:415-528)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422939Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1423096Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 1423097Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 1423137Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 1423138Species Cow (Bos taurus) [TaxId:9913] [55453] (11 PDB entries)
    Uniprot P80457
  8. 1423151Domain d3b9jb1: 3b9j B:415-528 [155002]
    Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj2, d3b9jk1, d3b9jk2
    automatically matched to d1fo4a4
    complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jb1

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
PDB Compounds: (B:) xanthine oxidase

SCOPe Domain Sequences for d3b9jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9jb1 d.87.2.1 (B:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOPe Domain Coordinates for d3b9jb1:

Click to download the PDB-style file with coordinates for d3b9jb1.
(The format of our PDB-style files is described here.)

Timeline for d3b9jb1: