SCOPe 2.08: Domain d3b9jb1: 3b9j B:415-528

Lineage for d3b9jb1 (3b9j B:415-528)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family

6. Protein automated matches [232090] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries)

8. Domain d3b9jb1: 3b9j B:415-528 [155002]
   Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj2, d3b9jk1, d3b9jk2
   automated match to d1v97a4
   complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jb1

PDB Entry: 3b9j, 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine

PDB Compounds: (B:) xanthine oxidase

SCOPe Domain Sequences for d3b9jb1:

Sequence; same for both SEQRES and ATOM records:

>d3b9jb1 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3b9jb1:

• d3b9jb1 first appeared in SCOP 1.75
  
• d3b9jb1 appears in SCOPe 2.07