SCOPe 2.08: Domain d3b9ja1: 3b9j A:93-164

Lineage for d3b9ja1 (3b9j A:93-164)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein Xanthine oxidase, domain 2 [47746] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
   Uniprot P80457

8. Domain d3b9ja1: 3b9j A:93-164 [155000]
   Other proteins in same PDB: d3b9ja2, d3b9jb1, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji2, d3b9jj1, d3b9jj2, d3b9jk1, d3b9jk2
   automated match to d1fiqa1
   complexed with 290, ca, fad, fes, mos, mte

Details for d3b9ja1

PDB Entry: 3b9j, 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine

PDB Compounds: (A:) xanthine oxidase

SCOPe Domain Sequences for d3b9ja1:

Sequence; same for both SEQRES and ATOM records:

>d3b9ja1 a.56.1.1 (A:93-164) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfa

Timeline for d3b9ja1:

• d3b9ja1 first appeared in SCOP 1.75
  
• d3b9ja1 appears in SCOPe 2.07