Lineage for d3b9ja1 (3b9j A:93-164)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715311Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 2715312Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
    Uniprot P80457
  8. 2715323Domain d3b9ja1: 3b9j A:93-164 [155000]
    Other proteins in same PDB: d3b9ja2, d3b9jb1, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji2, d3b9jj1, d3b9jj2, d3b9jk1, d3b9jk2
    automated match to d1fiqa1
    complexed with 290, ca, fad, fes, mos, mte

Details for d3b9ja1

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
PDB Compounds: (A:) xanthine oxidase

SCOPe Domain Sequences for d3b9ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9ja1 a.56.1.1 (A:93-164) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfa

SCOPe Domain Coordinates for d3b9ja1:

Click to download the PDB-style file with coordinates for d3b9ja1.
(The format of our PDB-style files is described here.)

Timeline for d3b9ja1: