SCOPe 2.01: Domain d1hdbd_: 1hdb D:

Lineage for d1hdbd_ (1hdb D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (196 PDB entries)
   Uniprot P68871

8. Domain d1hdbd_: 1hdb D: [15500]
   Other proteins in same PDB: d1hdba_, d1hdbc_
   complexed with hem, so4; mutant

Details for d1hdbd_

PDB Entry: 1hdb, 2.2 Å

PDB Description: analysis of the crystal structure, molecular modeling and infrared spectroscopy of the distal beta-heme pocket valine67(e11)-threonine mutation of hemoglobin

PDB Compounds: (D:) hemoglobin (deoxy) beta-v67t

SCOPe Domain Sequences for d1hdbd_:

Sequence; same for both SEQRES and ATOM records:

>d1hdbd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkktlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1hdbd_:

• d1hdbd_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdbd_ appears in SCOP 1.75
  
• d1hdbd_ appears in SCOPe 2.02
  
• d1hdbd_ appears in the current release, SCOPe 2.08