Lineage for d3b9ia_ (3b9i A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777280Protein Glucocorticoid-induced TNF-related ligand, TNFSF18 [158982] (4 species)
  7. 2777294Species Mouse (Mus musculus) [TaxId:10090] [158983] (4 PDB entries)
    Uniprot Q7TS55 51-173! Uniprot Q80YG2 49-173
  8. 2777301Domain d3b9ia_: 3b9i A: [154998]
    automated match to d2q8oa1

Details for d3b9ia_

PDB Entry: 3b9i (more details), 2.49 Å

PDB Description: crystal structure of mouse gitrl at 2.5 a.
PDB Compounds: (A:) GITR ligand

SCOPe Domain Sequences for d3b9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9ia_ b.22.1.1 (A:) Glucocorticoid-induced TNF-related ligand, TNFSF18 {Mouse (Mus musculus) [TaxId: 10090]}
scmvkfelssskwhmtspkphcvnttsdgklkilqsgtyliygqvipvdkkyikdnapfv
vqiykkndvlqtlmndfqilpiggvyelhagdniylkfnskdhiqktntywgiilmpdlp
fis

SCOPe Domain Coordinates for d3b9ia_:

Click to download the PDB-style file with coordinates for d3b9ia_.
(The format of our PDB-style files is described here.)

Timeline for d3b9ia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3b9ib_