SCOPe 2.07: Domain d3b9ba4: 3b9b A:1-124,A:240-343,A:751-994

Lineage for d3b9ba4 (3b9b A:1-124,A:240-343,A:751-994)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
   core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains

4. Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family)

5. Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)

6. Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
   the N-terminal 40 residues interact with /form a part of transduction domain A

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (43 PDB entries)
   Uniprot P04191

8. Domain d3b9ba4: 3b9b A:1-124,A:240-343,A:751-994 [154997]
   Other proteins in same PDB: d3b9ba1, d3b9ba2, d3b9ba3
   automated match to d1wpga4
   complexed with bef, mg, na

Details for d3b9ba4

PDB Entry: 3b9b, 2.65 Å

PDB Description: Structure of the E2 beryllium fluoride complex of the SERCA Ca2+-ATPase

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3b9ba4:

Sequence; same for both SEQRES and ATOM records:

>d3b9ba4 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

Timeline for d3b9ba4:

• d3b9ba4 first appeared in SCOP 1.75
  
• d3b9ba4 appears in SCOPe 2.06
  
• d3b9ba4 appears in the current release, SCOPe 2.08