SCOPe 2.03: Domain d3b9ba1: 3b9b A:125-239

Lineage for d3b9ba1 (3b9b A:125-239)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (37 PDB entries)
   Uniprot P04191

8. Domain d3b9ba1: 3b9b A:125-239 [154994]
   Other proteins in same PDB: d3b9ba2, d3b9ba3, d3b9ba4
   automated match to d1wpga1
   complexed with bef, mg, na

Details for d3b9ba1

PDB Entry: 3b9b, 2.65 Å

PDB Description: Structure of the E2 beryllium fluoride complex of the SERCA Ca2+-ATPase

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3b9ba1:

Sequence; same for both SEQRES and ATOM records:

>d3b9ba1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d3b9ba1:

• d3b9ba1 first appeared in SCOP 1.75
  
• d3b9ba1 appears in SCOPe 2.02
  
• d3b9ba1 appears in SCOPe 2.04
  
• d3b9ba1 appears in the current release, SCOPe 2.08